Games
-
Turbo Car RacingDownloadRacing 丨 19.4 MB
Theultimateracingexperiencethatwillkeepyouontheedgeofyourseat!TurboCarRacingisathrillingtop-downarcaderacinggamewherespeedandprecisionareyouronlyallies.Withasingle,meticulouslydesignedtrack,yourmissionissimple:travelasfarasyoucanwhileavoidingotherracers.Thegameisendless,meaningthechallengeneverstops
-
Sequence MasterDownloadPuzzle 丨 34.0 MB
Challengeyourbrainwithnumbers,letters,andcolorsinSequenceMaster!WelcometoSequenceMaster!Areyoureadytochallengeyourbrainandimproveyourmemory?DiveintotheexcitingworldofSequenceMaster,afunandaddictivegamethattestsyourcognitiveskillsthroughthreeengaginggamemodes.Perfectforplayersofallages,thisgameisdesi
-
Backpack AttackDownloadRole Playing 丨 116.1 MB
Prepare for strategic combat! In Backpack Attack, collect, combine, and battle with your ultimate arsenal. Each level presents unique challenges and enemies, demanding constant strategic adaptation. Master weapon placement and selection, ensuring optimal gear for every encounter. (Replace place
-
كنق الهجولهDownloadRacing 丨 248.1 MB
لعبهواقعيهللهجولهلعبهتتميزبوزنياتواقعيهجداوسياراتحصريهومعروفهللهجولهوالتفحيطلأياقتراحتواصلومعيعلىحسابيفيالانستقرام:MV4MWhat'sNewintheLatestVersion5.4LastupdatedonAug25,2023اصلاحاتعامةbugfixes
-
Rebirth OnlineDownloadRole Playing 丨 64.8 MB
Experience the best free open-world MMORPG with cross-platform play (including Steam)! Searching for a free, graphically stunning MMORPG playable across various devices? Look no further! Read previous reviews before diving in! Simply install and enjoy! Important Notes: We offer partial auto-pla
-
Real Drift Cars 2DownloadRacing 丨 149.5 MB
Drift,raceathighspeed,becomeachampion!Realdrivingandadrenalineawait!RealDriftCars2:TheUltimateDriftandRacingExperience!RealDriftCars2isaracinggamedesignedfordriftandspeedenthusiasts,featuringarealisticphysicsengine.MastertheartofdriftingwithlegendarycarsliketheM3E46,RX7Veilside,andScirocco.Testyours
-
Speed Passion RoadDownloadRacing 丨 12.2 MB
Ultra-realvisionracingexperiencegame!-Multi-location,multi-nationalracetracksandterrainmapsavailable-Awiderangeofexpensiveandflashycarstochoosefrom.-Ultra-realisticracingviewandfeelExperiencethegametogether!I
-
Endless DhakaDownloadRacing 丨 124.1 MB
Racewithyourfriendsindhakacity.AmultiplayerracinggamemainlybasedonDhaka,Bangladesh.Thegamewillhavemultipleracemodewithlatestandfastestcars
-
Jewels BlastDownloadPuzzle 丨 82.2 MB
Funandaddictivepuzzlegametomatchandcrush3diamonds!JewelsBlastisoneofthemostfunandaddictivepuzzlegameever!Matchingandcrushing3diamondsinarowwithyourinstinctandwinthegamebyusingstrategies!Also,withinthegame,youcangetfreerewardsandboosterstohelpyougettothenextlevels.Nowcomeandjointhisamazingcandyadvent
-
Jigsaw Puzzles for AdultsDownloadPuzzle 丨 118.4 MB
30000HDjigsawpuzzles.Offlinepicturepuzzlegame.Ajigsawpuzzleisthebestwaytospendyourleisuretime!10.000freejigsawpuzzlegamestoplay.Thousandsofcolorfuljigsawpuzzles.Findandopenmorehigh-qualitypacks!Newjigsawpuzzleseveryday.Solverelaxingpuzzlesonlineoroffline.Awideselectionofdifferentfreepuzzlesforadults
-
Christmas CookieDownloadPuzzle 丨 100.7 MB
FunChristmasGames!HelpSantaMatchChristmasCookiesinMatch3PuzzleGame!Ho!Ho!Ho!MerryChristmas!WelcometotheenchantingworldofChristmasCookie,thematch3gamesthat'ssettosprinkleholidaymagicintoyourgamingexperience.Thisdelightfulfree-to-playChristmasGames,boastsanimpressive3050+match3levels,alldesignedtoimme
-
Zoo MatchDownloadPuzzle 丨 92.3 MB
Funmatch3gametobuildyourdreamzoowithadorableanimals!WelcometoZooMatch,theultimatematch-3puzzlegamewhereyoucancreateyourdreamzoo!Solvematch3puzzlestounlockdifferentzooareasandanimals,anddesignyourownzoowithavarietyofdecorationsandhabitats!GameHighlightsTaptoswapformatch3!Funtoplayyetchallengingtomast
-
CarDash3DDownloadRacing 丨 187.3 MB
Racesky-hightracks,dodgeobstacles,leapgaps,andreachthefinish!Embarkonathrillingjourneyacrossafloatingracetrackhighaboveasprawlingcity!Inthishigh-altitudechallenge,playersmustnavigateadaringcoursesuspendedinthesky,avoidinggaps,obstacles,andsharpturns.Withthecityscapebelow,yourmissionistoreachthefinis
-
Catch Criminals Game 2025 ProDownloadRacing 丨 75.3 MB
Roamfreelyaroundthecityandcompletemissions.UPGRADEYOURCARS•Improveyourcarengines,torqueandtopspeedforbetterhighwayperformance.•IncreaseyourcarspeedbyaddingnitrotoyourcarCAREERMODE•Improveyourparkingskillswhileparkingyourcarwithparkinglevels.GetreadyforamultiplayerdriftraceinTrafficRacer'scareersecti
-
Closed Area LiteDownloadRacing 丨 66.6 MB
Travelthroughtheclosedareaofthetestsite,drivingGAZ3110Fullversiongame:https://play.google.com/store/apps/details?id=com.mikron.ClosedAreaFullFeaturestheLiteversionofthegame:-Onelocation;-Accelerometercontrol,withbuttonsoragamepad(testedondualshock4);-Gameonlyfirstpersonviewfromthecockpit,youcanlooka
-
Hexa Sync 3DDownloadPuzzle 丨 149.3 MB
SortandmergehexatilestocreatesatisfyingcolormatchesinHexaSync3DHexaSync3Ddeliversanexcitingfusionofstrategy,puzzle-solving,andsatisfyingmerginggameplay.Testyourbrainpowerwithcleverstackingandsortingmechanicsthatengageyourlogicalthinking,makingitperfectforthosewhoenjoyamentalchallenge.HexaSync3Dintro
-
Formula Classic - 90's RacingDownloadRacing 丨 113.6 MB
V10racecarsareback!Experiencetheloudenginesoundandtheinsanespeedof'90ssingleseaters!-10realtracksfromallovertheworld;-10differentteams,allfullycustomizable;-Raceagainst19opponentsinsingleraces,championshipandchallengetheworldintimeattackmode;-Differentweatherconditions;-5Differenttyresfordifferentst
-
Tile Connect - Match GamesDownloadPuzzle 丨 41.6 MB
Connectmatchingtiles,enjoymini-games,unlockskinsinthisfunpuzzlegame!WelcometoTileConnect-MatchGames,acreativeandfuntile-matchinggame!Inthisgame,you'llexperiencetheclassic"connectthetiles"gameplaywhileenjoyingawidevarietyofpowerfulpower-upsandexcitingmini-games.Challengeyourself,unlockdifferentskinsa
-
ゆるっとパズルDownloadPuzzle 丨 119.6 MB
Fullof“kawaii”!Charactersfrom"Kanahei'sSmallAnimals",whichattractfansaroundtheworld,arenowavailableasagame!Therearemanyfamiliarsmallanimals,including"Pisukeandtherabbit".Thistimetoo,wewilldeliveralotof"cute"!Thegenreisafamiliarmatch-3puzzle!Thegamegenreismatch-3puzzle,whichispopularamongawiderangeof
-
Hooves of FireDownloadRacing 丨 46.3 MB
Theultimate,realtime,multiplayerhorseracinggame!Playthemostexcitingsocialhorseracinggameonmobileorthewebatwww.hoovesoffire.comBuy,sell,train,breedandraceyourownhorses.-Realtimemultiplayerhorseracing-Placeyourbets,enteryourhorsesandsitbacktowatchtheracesruninrealtime.-Breedastableofchampions-Trainyou
-
Car Crash MayhemDownloadRacing 丨 455.3 MB
Realisticcrasheswith114vehicles.Choosecrashtestdummiesorgowithout!HittiteGamesproudlypresentsitsnewgame,CarCrashMayhem!InCarCrashMayhem,youcanchoosetoincludecrashtestdummiesornotasyouexperiencerealisticdamagewith114differentvehicles.Enjoyexcitingandthrillingcrasheswithavarietyofvehicles,includingcar
-
Car ObbyDownloadRacing 丨 110.0 MB
ParkourObbyGame!Choosethecar&startmountainclimbstuntcarracinggamesGetreadyfortheultimatedrivingadventureinCarObby–amegastuntracinggamelikenoother!CarObbyisapopulargamethatcombinestheexcitementofracingwithchallengingobstaclecourses,alsoknownasobbytracks.Unliketraditionalobbygameswhereplayersnavigateo
-
Real OffroadDownloadRacing 丨 191.2 MB
Conquerdirtracingwith4x4mudtrucks,cars&jeepsinthisoffroadadventure!WelcometoRealOffroad4x4MudTrucks,theultimatedrivinggamewhereyoucanfeelthethrillofrealoffroadcarracing.Whetheryou'renavigatingruggedterrainsinmudtrucks,challengingtimelimits,orexploringvastlandscapeswithyour4x4,thisgameoffersarealisti
-
Earn to Survive - Zombie CrushDownloadRacing 丨 90.6 MB
EarntoSurviveis2dgameinwhichescapefromzombiesbyupgradingcarCrushthezombiesisbestactionstunt2denvironmenthazardssurvivalgameinwhichplayerdrivecarthroughdifferentenvironmentalenemies.Youaretheonlyskilleddriverwholeftaliveonthispostapocalypticdeadlyenvironment.Don'tdietoyoungdrivethroughandcrusheveryth
-
Bubble Shooting QuestDownloadPuzzle 丨 139.3 MB
BetheBubbleShooter!Aimandpopcolorfulbubblesforasatisfyingexperience!"BubbleShootingQuest"iswaitingforyou,filledwithnewlevelsandchallengingmissions.Anaddictivebubblepuzzlegameyoucanenjoyanytime,anywhere![Features]■ExcitingBubbleShootingQuest!Aimatbubblesofthesamecolorandpopthem!Simpleyetcaptivatingga
-
هجولة مطانيخDownloadRacing 丨 154.8 MB
ملكالهجولةوالطارة,اجملواطنخلعبةهجولة,ابدأبالهجولةالآنلعبههجولهالنسخةالمطورةوالاحترافيةلعبةسياراتشبيههبالواقعبجرافيكسخفيفوحجمصغيروميزاتكثيرة..سيارتمشهورةومعروفةبعدةموديلات(كامري,هوندا,داتسون,هايلوكس,جمس,فورد,والكثير)تعديلشكلالسيارةقمبتعديلوزينةسيارتك:1/ترفيعأماميوترفيعخلفي2/إمالةوتحديبالكفراتالأمامية
-
Teva RunDownloadRacing 丨 180.6 MB
Outrace,Outsmart,Outlast–TheUltimateRacingAdventure!Mastertheartofracingandstrategyin'TevaRun',theultimatemultiplayerracingadventure!Navigatethroughanarrayofchallengesasyouskillfullydodgetrapsandavoidobstacles.Utilizeyourpower-upswiselytogainanedgeandcrossthefinishlinefirst.Immerseyourselfindiversea
-
Crazy Goods Sort 3DDownloadPuzzle 丨 40.7 MB
SortingpuzzlegamewithafreshtwistCrazyGoodsSort3Disafunandsatisfyingsortingpuzzlegamewithafreshtwist!Insteadofbottles,you’llorganizeandsortvariousgoods—likefood,makeup,toys,andmore—insidecolorfulboxes.Completeeachlayerofboxestounlockthenextandrevealevenmoreexcitingchallenges!Gameplay:Yourtaskissimple
-
Mobimi Car SimulatorDownloadRacing 丨 145.2 MB
Realisticcardriving,policechases&carcustomizationinMobimiCarSimulatorMobimiCarSimulator-ExperienceImmersiveCarDriving&PoliceChasesin2024!MobimiCarSimulatordeliversanauthenticcarsimulator3Dexperiencewithextremedrivingactionandintensepolicechases.Driveuniquecars,includingSUVs,driftcars,musclecars,anda
-
Block Rush - Block Puzzle GameDownloadPuzzle 丨 79.6 MB
Offlinepuzzlegame,brainstorminBlockRush!Colorfulmatchingrelaxesmind!Welcometo"BlockRush"!"BlockRush"isanattractiveandcomplimentaryblockpuzzlegamethatbecomesthego-tooptiontobothrelaxandengageyourcognitiveskills.Thisstimulatinggamehasasimpleobjective:strategicallyalignandeliminateasmanyvibrantblocksfr
-
Number Blocks Match Puzzle.DownloadPuzzle 丨 43.5 MB
Master the addictive number merging puzzle! "Number Blocks Match Puzzle" challenges you to combine numbers to create larger ones. The difficulty ramps up as numbers grow, demanding strategic planning for optimal point scoring. Reaching in-game goals also awards points, enhancing your competitive
-
Knights of Pen and Paper 3DownloadRole Playing 丨 212.1 MB
Embark on an epic pixel-art RPG adventure filled with mayhem and super fun! Knights of Pen and Paper 3 offers a captivating blend of classic turn-based combat and a compelling story-driven campaign. Roll the dice, customize your party, and show those bosses who's in charge! Journey to the mystical
-
테일즈 오브 크라운 : 방치형 RPGDownloadRole Playing 丨 1.1 GB
Embark on an epic idle RPG adventure with Beginner Knight Pi! Pi, a girl destined for knighthood, and Moko, a dutiful messenger of the goddess, must unite to save Natureland from the encroaching Dark Lord. Key Features: Become a True Hero: Confront the Dark Lord and prevent the destruction of Nat
-
Postknight 2DownloadRole Playing 丨 727.0 MB
Embark on an epic casual adventure RPG as a Postknight trainee! Your mission: deliver goods across the vibrant world of Prism. Explore boundless oceans, scorching deserts, colorful meadows, and towering mountains. Conquer monsters and become the ultimate Postknight! Dare you accept the challenge?
-
Police Car Parking Car Game 3DDownloadRole Playing 丨 67.8 MB
Master the art of police car parking with this thrilling 3D police car game! Sharma Gaming Studio presents a challenging and exciting police car parking simulator. Ready to become a skilled police car driver? Download Police Car Parking Game 2024 and hone your parking and driving skills to become a
-
Ninja - Text RPGDownloadRole Playing 丨 89.7 MB
Anime-Themed Ninja Text RPG Adventure Embark on a solo, turn-based text RPG adventure inspired by D&D mechanics. Choose from unique character classes and set out to achieve your goals. Along the way, craft items, purchase property, engage in trade, lead rebellions, conquer cities, and even rise to
-
TheTownDownloadRole Playing 丨 77.1 MB
This standalone ARPG offers a unique gameplay experience focused on monster slaying and gear enhancement. Enjoy unlimited farming opportunities, complemented by a robust forging system, pet system, and diverse training options. Grab your weapons and embark on an epic adventure!
-
DragonheirDownloadRole Playing 丨 148.4 MB
Dive into the captivating world of Dragonheir: Silent Gods, a high-fantasy, open-world RPG brimming with strategic combat and over 200 unique heroes to command. Embark on a multiversal adventure where every decision shapes your destiny. Event News: The Blue Oak awakens, bringing a bountiful harvest
-
JourneyDownloadRole Playing 丨 658.5 MB
Embark on an unforgettable adventure to the land of your dreams! Journey of Monarch Grand Opening! About the Game Journey of Monarch brings fantasy to life. Explore vast, limitless landscapes and fulfill your aspirations in the world of Aden. As the Monarch, you lead the journey. Embark on a new ad
Home
Navigation